For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.| Introduction | Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candiadate for vaccine development. |
| Synonyms | Papillomavirus, HPV, Papilloma Virus. |
| Source | E.Coli. |
| Physical Appearance | Sterile filtered clear liquid formulation. |
| Formulation | PBS, 0.5M urea and 0.02% Sodium Azide. |
| Stability | Recombinant HPV-11 althoµgh stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Amino Acid Sequence | VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQM |
| Purity | Protein is >95% pure as determined by 12% PAGE (coomassie staining). |
| Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
| Applications | Each laboratory should determine an optimum working titer for use in its particular application. |
N/A
N/A